TOE1 Antibody - BSA Free

Western Blot: TOE1 Antibody [NBP3-10434] - Western blot analysis using NBP3-10434 on Mouse Liver as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TOE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TOE1 Antibody - BSA Free (NBP3-10434) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TOE1 (NP_080930). Peptide sequence QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TOE1 Antibody - BSA Free

• FLJ13949
• target of EGR1 protein 1
• target of EGR1, member 1 (nuclear)

Background

TOE1 inhibits cell growth rate and cell cycle. Induces CDKN1A expression as well as TGF-beta expression. Mediatesthe inhibitory growth effect of EGR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOE1