TNFAIP8L2 Antibody - Azide and BSA Free

Western Blot: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of extracts of various cell lines, using TNFAIP8L2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Immunoprecipitation: TNFAIP8L2 Antibody [NBP2-93009] - Immunoprecipitation analysis of 25ug extracts of Mouse spleen cells using 3ug TNFAIP8L2 antibody (NBP2-93009). Western blot was performed from the immunoprecipitate using TNFAIP8L2 antibody (NBP2-93009) at a dilution of 1:1000.

Immunocytochemistry/Immunofluorescence: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of L929 cells using TNFAIP8L2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of HeLa cells using TNFAIP8L2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009] - Immunofluorescence analysis of C6 cells using TNFAIP8L2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TNFAIP8L2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TNFAIP8L2 Antibody - Azide and BSA Free (NBP2-93009) is a polyclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2). MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFAIP8L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TNFAIP8L2 Antibody - Azide and BSA Free

• FLJ23467
• Inflammation factor protein 20
• TIPE2
• TIPE2inflammation factor 20
• TNF alpha-induced protein 8-like protein 2
• TNFAIP8-like protein 2
• tumor necrosis factor alpha-induced protein 8-like protein 2
• tumor necrosis factor, alpha-induced protein 8-like 2
• tumor necrosis factor, alpha-induced protein 8-like protein 2

Background

TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negativeregulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system andmaintains immune homeostasis. Inhibi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TNFAIP8L2