![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining in human kidney and lymph node tissues using anti-TMEM72 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0004.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining in human kidney and lymph node tissues using anti-TMEM72 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM72 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human and Mouse | 12/16/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 12/16/2016 |
||
| Application: | WB | |
| Species: | Human and Mouse |
| Gene Symbol | TMEM72 |
![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody NBP2-49377 (A) shows similar protein distribution across tissues to independent antibody NBP1-90808 (B).](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0005.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody NBP2-49377 (A) shows similar protein distribution across tissues to independent antibody NBP1-90808 (B).")
![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0007.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0002.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0003.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human colon.](http://images.novusbio.com/fullsize/TMEM72-Antibody-Immunohistochemistry-Paraffin-NBP2-49377-img0006.jpg "Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP2-49377] - Staining of human colon.")
![SDS-PAGE TWEAK/TNFSF12 [Unconjugated]](https://images.novusbio.com/images2/TWEAK_1090-TW_CF_655.jpg)
![Bioactivity TWEAK/TNFSF12 [Unconjugated]](https://images.novusbio.com/images2/TWEAK_1090-TW_CF_657.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Western_Blot_16723.jpg)
![Simple Western DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_17635.jpg)
![Immunohistochemistry DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_7152.jpg)
![Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIII_AF1597_Western_Blot_23213.jpg)
![SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_411.jpg)
![Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_491.jpg)
![SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images/4325-fc_recombinant-human-fc-gamma-riiia-cd16a-protein-cf-sec-mals-2842023172947.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
