TMEM72 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP1-90808] - Analysis in human kidney and liver tissues using NBP1-90808 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP1-90808] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody NBP1-90808 (A) shows similar protein distribution across tissues to independent antibody NBP2-49377 (B).

Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP1-90808] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP1-90808] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: TMEM72 Antibody [NBP1-90808] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human Liver shows no positivity in hepatocytes as expected.

Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in distal tubules.

Analysis in human kidney and liver tissues using NBP1-90808 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues.

Staining of human Lymph node shows no positivity in non-germinal center cells as expected.

Staining of human cerebral cortex).

Staining of human Cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM72 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM72 Antibody - BSA Free (NBP1-90808) is a polyclonal antibody validated for use in IHC. Anti-TMEM72 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM72
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMEM72 Protein (NBP1-90808PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%). Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM72 Antibody - BSA Free

• bA285G1.3
• C10orf127
• DKFZp686M0585
• kidney-specific secretory protein of 37 kDa
• KSP37
• MGC157906
• transmembrane protein 72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM72 Antibody (NBP1-90808)(1)

Publication using NBP1-90808

• Fagerberg L, Hallstrom BM, Oksvold P et al. Analysis of the Human Tissue-specific Expression by Genome-wide Integration of Transcriptomics and Antibody-based Proteomics. Mol Cell Proteomics 2014-02-01 [PMID: 24309898]

Review for TMEM72 Antibody (NBP1-90808) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human and Mouse.

reviewed by: Verified Customer WB Human and Mouse 11/30/2016

Summary

• Application: Western Blot
• Sample Tested: HEK 293 cell lysate
• Species: Human and Mouse
• Lot: R36645

Bioinformatics

• Gene Symbol: TMEM72