TMEM49 Antibody

Images

 
Western Blot: TMEM49 Antibody [NBP2-88441] - Host: Rabbit. Target Name: VMP1. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM49 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TMEM49. Peptide sequence: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (93%), Guinea Pig (100%), Equine (100%), Canine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
VMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM49 Antibody

  • DKFZp566I133
  • EPG3
  • TDC1
  • transmembrane protein 49TMEM49
  • vacuole membrane protein 1

Background

Transmembrane protein 49 (TMEM49, theoretical molecular weight 46kDa) also known as vacuole membrane protein 1 (VMP1) is localized to the endoplasmic reticulum of ancinar rat cells where its expression is inducible by stress (1). Expression of VMP1 is upregulated in experimental models of rat pancreatitis. In the amoeba Dictyostelium discoideum, VMP1 is critical for endoplasmic reticulum integrity and also plays a role in Dictyostelium's development (2). VMP1 localizes to the plasma membrane in cells in culture (e.g., HEK293 and Caki-2 cell lines) where it functions in cell to cell contact and regulates cell adhesion (1). Overexpression of VMP1 in vitro is associated with the formation of vacuoles and cell death (2).

VMP1 was first implicated in the process of autophagy through in vitro cell culture studies (2, 3). In mammalian cells, expression of VMP1 induces autophagy and absence of VMP1 expression inhibits autophagy. VMP1 interacts with the BH3 domain of Beclin-1 and promotes the early steps of autophagosome formation (4). VMP1 expression is implicated in various pathological conditions including type I diabetes, pancreatitis, and pancreatic cancer (4).

References

1. Sauermann, M., Sahin, O., Sultmann, H., Hahne, F., Blaszkiewicz, S., Majety, M.,... Arlt, D. (2008). Reduced expression of vacuole membrane protein 1 affects the invasion capacity of tumor cells. Oncogene. https://doi.org/10.1038/sj.onc.1210743

2. Calvo-Garrido, J., Carilla-Latorre, S., Lazaro-Dieguez, F., Egea, G., & Escalante, R. (2008). Vacuole membrane protein 1 is an endoplasmic reticulum protein required for organelle biogenesis, protein secretion, and development. Molecular Biology of the Cell. https://doi.org/10.1091/mbc.E08-01-0075

3. Calvo-Garrido, J., Carilla-Latorre, S., & Escalante, R. (2008). Vacuole membrane protein 1, autophagy and much more. Autophagy. https://doi.org/10.4161/auto.6574

4. Molejon, M. I., Ropolo, A., & Vaccaro, M. I. (2013). VMP1 is a new player in the regulation of the autophagy-specific phosphatidylinositol 3-kinase complex activation. Autophagy. https://doi.org/10.4161/auto.24390

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-02627
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46587
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76638
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-71704
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for TMEM49 Antibody (NBP2-88441) (0)

There are no publications for TMEM49 Antibody (NBP2-88441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM49 Antibody (NBP2-88441) (0)

There are no reviews for TMEM49 Antibody (NBP2-88441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM49 Antibody (NBP2-88441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM49 Products

Bioinformatics Tool for TMEM49 Antibody (NBP2-88441)

Discover related pathways, diseases and genes to TMEM49 Antibody (NBP2-88441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM49 Antibody (NBP2-88441)

Discover more about diseases related to TMEM49 Antibody (NBP2-88441).
 

Pathways for TMEM49 Antibody (NBP2-88441)

View related products by pathway.

PTMs for TMEM49 Antibody (NBP2-88441)

Learn more about PTMs related to TMEM49 Antibody (NBP2-88441).
 

Research Areas for TMEM49 Antibody (NBP2-88441)

Find related products by research area.

Blogs on TMEM49

There are no specific blogs for TMEM49, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM49 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VMP1