TMEM38B Antibody

Images

 
Western Blot: TMEM38B Antibody [NBP1-88803] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: TMEM38B Antibody [NBP1-88803] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM38B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM38B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM38B Protein (NBP1-88803PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM38B Antibody

  • bA219P18.1
  • chromosome 9 open reading frame 87
  • D4Ertd89e
  • FLJ10493
  • transmembrane protein 38BC9orf87
  • TRIC-BTRICB
  • trimeric intracellular cation channel type B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13452
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF7726
Species: Hu
Applications: WB, IHC
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-76778
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85021
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57078
Species: Hu
Applications: ICC/IF
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for TMEM38B Antibody (NBP1-88803) (0)

There are no publications for TMEM38B Antibody (NBP1-88803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM38B Antibody (NBP1-88803) (0)

There are no reviews for TMEM38B Antibody (NBP1-88803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM38B Antibody (NBP1-88803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM38B Products

Bioinformatics Tool for TMEM38B Antibody (NBP1-88803)

Discover related pathways, diseases and genes to TMEM38B Antibody (NBP1-88803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM38B Antibody (NBP1-88803)

Discover more about diseases related to TMEM38B Antibody (NBP1-88803).
 

Pathways for TMEM38B Antibody (NBP1-88803)

View related products by pathway.

Blogs on TMEM38B

There are no specific blogs for TMEM38B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM38B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM38B