Recombinant Human TMEM38A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM38A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-299 of Human TMEM38A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPIASWLCAMLHCFGSYILADLLLGEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFVMIATGWVKGSGVALMSNFEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFIFTLFMVSCKVFLTATHSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMEM38A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM38A Protein

  • transmembrane protein 38ATRIC-AMGC3169
  • TRICA
  • trimeric intracellular cation channel type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-77093
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34184
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-82840
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85184
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079041-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM38A Recombinant Protein (H00079041-P01) (0)

There are no publications for TMEM38A Recombinant Protein (H00079041-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM38A Recombinant Protein (H00079041-P01) (0)

There are no reviews for TMEM38A Recombinant Protein (H00079041-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM38A Recombinant Protein (H00079041-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM38A Products

Bioinformatics Tool for TMEM38A Recombinant Protein (H00079041-P01)

Discover related pathways, diseases and genes to TMEM38A Recombinant Protein (H00079041-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM38A Recombinant Protein (H00079041-P01)

Discover more about diseases related to TMEM38A Recombinant Protein (H00079041-P01).

Blogs on TMEM38A

There are no specific blogs for TMEM38A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM38A Antibody
NBP2-13452
HSP60 Antibody
NBP1-77397

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM38A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM38A