TMEM200C Recombinant Protein Antigen

Images

 
There are currently no images for TMEM200C Protein (NBP2-30818PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMEM200C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM200C.

Source: E.coli

Amino Acid Sequence: GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMEM200C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-30818.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TMEM200C Recombinant Protein Antigen

  • TMEM200C
  • Transmembrane Protein TTMA
  • TTMA
  • Two Transmembrane Domain Family Member A
  • Two Transmembrane Domain-Containing Family Member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-47612
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
H00006925-M03
Species: Hu, Rt, Rb
Applications: WB, ELISA, ICC/IF
NBP2-57496
Species: Hu
Applications: ICC/IF
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-57508
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, IHC, IHC-P
NBP1-85945
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NBP1-84916
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30818PEP
Species: Hu
Applications: AC

Publications for TMEM200C Protein (NBP2-30818PEP) (0)

There are no publications for TMEM200C Protein (NBP2-30818PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM200C Protein (NBP2-30818PEP) (0)

There are no reviews for TMEM200C Protein (NBP2-30818PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMEM200C Protein (NBP2-30818PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional TMEM200C Products

Bioinformatics Tool for TMEM200C Protein (NBP2-30818PEP)

Discover related pathways, diseases and genes to TMEM200C Protein (NBP2-30818PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM200C

There are no specific blogs for TMEM200C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TCF4 Antibody (1G4)
H00006925-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMEM200C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM200C