TMEM2 Antibody

Images

 
Orthogonal Strategies: Western Blot: TMEM2 Antibody [NBP1-94168] - Analysis in human cell lines A-549 and PC-3 using anti-TMEM2 antibody. Corresponding TMEM2 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: TMEM2 Antibody [NBP1-94168] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human Fallopian tube shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: TMEM2 Antibody [NBP1-94168] - Staining of human small intestine shows moderate positivity in apical membranes in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TMEM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM2 Protein (NBP1-94168PEP)
Publications
Read Publication using
NBP1-94168 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM2 Antibody

  • CEMIP2
  • KIAA1412
  • TMEM2
  • transmembrane protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-05608
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-92895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
BC110-60479
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP2-68658
Species: Hu
Applications: ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NB100-2289
Species: Hu, Mu, Rt, Gp
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NBP1-77238
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-93561
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Av-Du, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
7044-CB
Species: Hu
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF6740
Species: Hu
Applications: IHC
NBP1-94168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TMEM2 Antibody (NBP1-94168)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM2 Antibody (NBP1-94168) (0)

There are no reviews for TMEM2 Antibody (NBP1-94168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEM2 Antibody (NBP1-94168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM2 Products

Array NBP1-94168

Bioinformatics Tool for TMEM2 Antibody (NBP1-94168)

Discover related pathways, diseases and genes to TMEM2 Antibody (NBP1-94168). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM2 Antibody (NBP1-94168)

Discover more about diseases related to TMEM2 Antibody (NBP1-94168).
 

Pathways for TMEM2 Antibody (NBP1-94168)

View related products by pathway.

Blogs on TMEM2

There are no specific blogs for TMEM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM2