TMEM184A Antibody

Images

 
Immunohistochemistry: TMEM184A Antibody [NBP2-49656] - Staining of human tonsil shows membrane and cytoplasmic positivity in a subset of leukocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM184A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM184A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM184A Recombinant Protein Antigen (NBP2-49656PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM184A Antibody

  • FLJ24011
  • transmembrane protein 184A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-76899
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-61822
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-85610
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
MAB2568
Species: Mu
Applications: IHC, WB
NBP1-94053
Species: Hu
Applications: IHC, IHC-P
NB600-799
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF8107
Species: Hu
Applications: IHC, WB
AF6854
Species: Hu
Applications: WB
NB100-81652
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
NBP2-45736
Species: Hu
Applications: IHC, IHC-P, WB
H00005097-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for TMEM184A Antibody (NBP2-49656) (0)

There are no publications for TMEM184A Antibody (NBP2-49656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM184A Antibody (NBP2-49656) (0)

There are no reviews for TMEM184A Antibody (NBP2-49656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM184A Antibody (NBP2-49656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM184A Products

Bioinformatics Tool for TMEM184A Antibody (NBP2-49656)

Discover related pathways, diseases and genes to TMEM184A Antibody (NBP2-49656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM184A Antibody (NBP2-49656)

Discover more about diseases related to TMEM184A Antibody (NBP2-49656).
 

Pathways for TMEM184A Antibody (NBP2-49656)

View related products by pathway.

Blogs on TMEM184A

There are no specific blogs for TMEM184A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM184A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM184A