TMEM121 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM121 Antibody [NBP2-14693] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: TMEM121 Antibody [NBP2-14693] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TMEM121 Antibody [NBP2-14693] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMEM121 Antibody [NBP2-14693] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMEM121 Antibody [NBP2-14693] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM121 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVP
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM121
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM121 Protein (NBP2-14693PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM121 Antibody

  • hole
  • transmembrane protein 121

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NBP1-62583
Species: Hu
Applications: WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-62667
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-Fr, IHC-P, IP
NBP3-11412
Species: Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-83530
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-14693
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for TMEM121 Antibody (NBP2-14693) (0)

There are no publications for TMEM121 Antibody (NBP2-14693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM121 Antibody (NBP2-14693) (0)

There are no reviews for TMEM121 Antibody (NBP2-14693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM121 Antibody (NBP2-14693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM121 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM121