TMEM106B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM106B Antibody [NBP2-31714] - Staining of human cell line A549 shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: TMEM106B Antibody [NBP2-31714] - Staining of human hippocampus shows moderate granular cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM106B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM106B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM106B Recombinant Protein Antigen (NBP2-31714PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM106B Antibody

  • TMEM106B
  • transmembrane protein 106B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2420
Species: Hu
Applications: WB, IHC
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for TMEM106B Antibody (NBP2-31714) (0)

There are no publications for TMEM106B Antibody (NBP2-31714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM106B Antibody (NBP2-31714) (0)

There are no reviews for TMEM106B Antibody (NBP2-31714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM106B Antibody (NBP2-31714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM106B Products

Bioinformatics Tool for TMEM106B Antibody (NBP2-31714)

Discover related pathways, diseases and genes to TMEM106B Antibody (NBP2-31714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM106B Antibody (NBP2-31714)

Discover more about diseases related to TMEM106B Antibody (NBP2-31714).
 

Pathways for TMEM106B Antibody (NBP2-31714)

View related products by pathway.

PTMs for TMEM106B Antibody (NBP2-31714)

Learn more about PTMs related to TMEM106B Antibody (NBP2-31714).

Blogs on TMEM106B

There are no specific blogs for TMEM106B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM106B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM106B
Entrez
Uniprot