TMEM100 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM100 Antibody [NBP2-30908] - Staining of human placenta shows moderate membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: TMEM100 Antibody [NBP2-30908] - Staining of human cerebral cortex shows moderate cytoplasmic/ membranous positivity in neurons.

Immunohistochemistry-Paraffin: TMEM100 Antibody [NBP2-30908] - Staining of human lung shows weak membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: TMEM100 Antibody [NBP2-30908] - Staining of human small intestine shows moderate cytoplasmic positivity in peripheral ganglion.

Product Discontinued

TMEM100 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM100
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM100 Antibody - BSA Free

• FLJ10970
• FLJ37856
• transmembrane protein 100

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM100
• Uniprot:
  • Q9NV29(Human)