TMC6 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMC6 Antibody [NBP2-13438] - Staining of human prostate shows moderate nuclear, cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMC6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMC6 Antibody - BSA Free (NBP2-13438) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMC6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMC6 Protein (NBP2-13438PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMC6 Antibody - BSA Free

• epidermodysplasia verruciformis 1
• Epidermodysplasia verruciformis protein 1
• EVER1FLJ17776
• EVIN1EV1
• expressed in activated T/LAK lymphocytes
• LAK-4P
• Protein LAK-4
• transmembrane channel-like 6
• transmembrane channel-like protein 6

Background

SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in placenta, prostate, testis, activated T-lymphocytes and lymphokine-activated killer (LAK) lymphocytes. DISEASE: Defects in TMC6 are a cause of epidermodysplasia verruciformis. It is a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMC6