TMC6 Antibody

Images

 
Immunohistochemistry-Paraffin: TMC6 Antibody [NBP2-13438] - Staining of human prostate shows moderate nuclear, cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLV KELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMC6 Protein (NBP2-13438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMC6 Antibody

  • epidermodysplasia verruciformis 1
  • Epidermodysplasia verruciformis protein 1
  • EVER1FLJ17776
  • EVIN1EV1
  • expressed in activated T/LAK lymphocytes
  • LAK-4P
  • Protein LAK-4
  • transmembrane channel-like 6
  • transmembrane channel-like protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76903
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-88816
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92514
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TMC6 Antibody (NBP2-13438) (0)

There are no publications for TMC6 Antibody (NBP2-13438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMC6 Antibody (NBP2-13438) (0)

There are no reviews for TMC6 Antibody (NBP2-13438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMC6 Antibody (NBP2-13438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMC6 Products

Bioinformatics Tool for TMC6 Antibody (NBP2-13438)

Discover related pathways, diseases and genes to TMC6 Antibody (NBP2-13438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMC6 Antibody (NBP2-13438)

Discover more about diseases related to TMC6 Antibody (NBP2-13438).
 

Pathways for TMC6 Antibody (NBP2-13438)

View related products by pathway.

Blogs on TMC6

There are no specific blogs for TMC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMC6