TM9SF1 Antibody


Western Blot: TM9SF1 Antibody [NBP1-69486] - This Anti-TM9SF1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: TM9SF1 Antibody [NBP1-69486] - Staining of human kidney.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TM9SF1 Antibody Summary

Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the N terminal of TM9SF1. Peptide sequence EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TM9SF1 Antibody

  • HMP70
  • MP70 protein family member
  • MP70
  • multispanning membrane protein (70kD)
  • transmembrane 9 superfamily member 1
  • transmembrane protein 9 superfamily member 1


TM9SF1 may function as channel, small molecule transporter or receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TM9SF1 Antibody (NBP1-69486) (0)

There are no publications for TM9SF1 Antibody (NBP1-69486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM9SF1 Antibody (NBP1-69486) (0)

There are no reviews for TM9SF1 Antibody (NBP1-69486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM9SF1 Antibody (NBP1-69486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TM9SF1 Products

Bioinformatics Tool for TM9SF1 Antibody (NBP1-69486)

Discover related pathways, diseases and genes to TM9SF1 Antibody (NBP1-69486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM9SF1 Antibody (NBP1-69486)

Discover more about diseases related to TM9SF1 Antibody (NBP1-69486).

Pathways for TM9SF1 Antibody (NBP1-69486)

View related products by pathway.

Blogs on TM9SF1

There are no specific blogs for TM9SF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TM9SF1 Antibody and receive a gift card or discount.


Gene Symbol TM9SF1