TM9SF1 Antibody

Images

 
Western Blot: TM9SF1 Antibody [NBP1-69486] - This Anti-TM9SF1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: TM9SF1 Antibody [NBP1-69486] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM9SF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the N terminal of TM9SF1. Peptide sequence EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM9SF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TM9SF1 Antibody

  • HMP70
  • MP70 protein family member
  • MP70
  • multispanning membrane protein (70kD)
  • transmembrane 9 superfamily member 1
  • transmembrane protein 9 superfamily member 1

Background

TM9SF1 may function as channel, small molecule transporter or receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58661
Species: Hu
Applications: IHC-P
NBP2-58660
Species: Hu
Applications: IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-62297
Species: Hu
Applications: WB
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF4914
Species: Hu
Applications: WB
AF4977
Species: Mu
Applications: WB
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-69486
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TM9SF1 Antibody (NBP1-69486) (0)

There are no publications for TM9SF1 Antibody (NBP1-69486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM9SF1 Antibody (NBP1-69486) (0)

There are no reviews for TM9SF1 Antibody (NBP1-69486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM9SF1 Antibody (NBP1-69486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM9SF1 Products

Bioinformatics Tool for TM9SF1 Antibody (NBP1-69486)

Discover related pathways, diseases and genes to TM9SF1 Antibody (NBP1-69486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM9SF1 Antibody (NBP1-69486)

Discover more about diseases related to TM9SF1 Antibody (NBP1-69486).
 

Pathways for TM9SF1 Antibody (NBP1-69486)

View related products by pathway.

Blogs on TM9SF1

There are no specific blogs for TM9SF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM9SF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM9SF1
Uniprot