We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TLK1 Recombinant Protein Antigen

Images

 
There are currently no images for TLK1 Protein (NBP1-83035PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TLK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TLK1.

Source: E. coli

Amino Acid Sequence: ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TLK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83035.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TLK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0137serine/threonine-protein kinase tousled-like 1
  • PKU-beta
  • SNARE protein kinase SNAK
  • tousled-like kinase 1serine threonine protein kinase

Background

Tousled-like kinase 1 (TLK1) is a serine/threonine kinase involved in chromatin assembly and the DNA damage response. The tousled (Tsl) kinase was first identified in Arabidopsis thaliana and speculated to be involved in cell division during patterning of plant organs. There are two tousled-like kinases in humans, TLK1 and TLK2, that can dimerize or heterodimerize for function and can be phosphorylated and inactivated by Chk1 in response to DNA damage. The histone chaperone, Asf1 (anti-silencing function 1), has been reported as a substrate for both TLK1 and TLK2. TLK1 has also been shown to be important for cell cycle progression and proper chromosome segregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12189
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC, IF, IHC,  IHC-P, IP, WB
NBP2-61684
Species: Hu, Pm, Mu
Applications: ELISA, Flow, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
1129-ER
Species: Hu
Applications: BA
NB120-13600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00011011-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85351
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-07996
Species: Hu
Applications: WB
NBP1-83035PEP
Species: Hu
Applications: AC

Publications for TLK1 Protein (NBP1-83035PEP) (0)

There are no publications for TLK1 Protein (NBP1-83035PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLK1 Protein (NBP1-83035PEP) (0)

There are no reviews for TLK1 Protein (NBP1-83035PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TLK1 Protein (NBP1-83035PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLK1 Products

Research Areas for TLK1 Protein (NBP1-83035PEP)

Find related products by research area.

Blogs on TLK1

There are no specific blogs for TLK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TLK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TLK1