TIS11D Antibody

Images

 
Western Blot: TIS11D Antibody [NBP2-83655] - WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysateZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIS11D Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TIS11D. Peptide sequence: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP36L2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for TIS11D Antibody

  • HF.10
  • HF10Zinc finger protein HF.10
  • Zfp105
  • zinc finger protein 35 (clone HF.10)
  • zinc finger protein 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02105
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
AF4245
Species: Hu
Applications: WB, IP
NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00026469-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-32622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026469-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
H00006621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-88319
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for TIS11D Antibody (NBP2-83655) (0)

There are no publications for TIS11D Antibody (NBP2-83655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIS11D Antibody (NBP2-83655) (0)

There are no reviews for TIS11D Antibody (NBP2-83655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIS11D Antibody (NBP2-83655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIS11D Products

Bioinformatics Tool for TIS11D Antibody (NBP2-83655)

Discover related pathways, diseases and genes to TIS11D Antibody (NBP2-83655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIS11D Antibody (NBP2-83655)

Discover more about diseases related to TIS11D Antibody (NBP2-83655).
 

Pathways for TIS11D Antibody (NBP2-83655)

View related products by pathway.

PTMs for TIS11D Antibody (NBP2-83655)

Learn more about PTMs related to TIS11D Antibody (NBP2-83655).

Blogs on TIS11D

There are no specific blogs for TIS11D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIS11D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP36L2