Recombinant Human TIN-Ag Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TIN-Ag Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2-100 of Human TINAG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TINAG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TIN-Ag Protein

  • TIN1
  • TIN2
  • TINAg
  • TIN-Ag
  • tubulointerstitial nephritis antigen

Background

TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
MAB7185
Species: Hu
Applications: WB, Simple Western
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
H00004867-D01P
Species: Hu, Mu
Applications: WB
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-81826
Species: Hu
Applications: IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7475
Species: Hu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027283-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TIN-Ag Partial Recombinant Protein (H00027283-Q01) (0)

There are no publications for TIN-Ag Partial Recombinant Protein (H00027283-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIN-Ag Partial Recombinant Protein (H00027283-Q01) (0)

There are no reviews for TIN-Ag Partial Recombinant Protein (H00027283-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIN-Ag Partial Recombinant Protein (H00027283-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIN-Ag Products

Bioinformatics Tool for TIN-Ag Partial Recombinant Protein (H00027283-Q01)

Discover related pathways, diseases and genes to TIN-Ag Partial Recombinant Protein (H00027283-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIN-Ag Partial Recombinant Protein (H00027283-Q01)

Discover more about diseases related to TIN-Ag Partial Recombinant Protein (H00027283-Q01).
 

Pathways for TIN-Ag Partial Recombinant Protein (H00027283-Q01)

View related products by pathway.

PTMs for TIN-Ag Partial Recombinant Protein (H00027283-Q01)

Learn more about PTMs related to TIN-Ag Partial Recombinant Protein (H00027283-Q01).

Blogs on TIN-Ag

There are no specific blogs for TIN-Ag, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TIN-Ag Antibody
NBP1-86307

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TIN-Ag Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TINAG
Entrez