Timeless Antibody - BSA Free

Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] -Analysis in human tonsil and cerebral cortex tissues using NBP2-32559 antibody. Corresponding TIMELESS RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Timeless Antibody [NBP2-32559] - Staining of human cell line MCF7 shows localization to nucleus.

Western Blot: Timeless Antibody [NBP2-32559] -Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human skin shows moderate nuclear positivity in a subset of squamous epithelial cells.

Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Timeless Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Timeless Antibody - BSA Free (NBP2-32559) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLQELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMELESS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Timeless Protein (NBP2-32559PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Timeless Antibody - BSA Free

• FLJ12640
• hTIMTIMELESS1
• TIM1protein timeless homolog
• timeless (Drosophila) homolog
• timeless homolog (Drosophila)
• TIMFLJ20714

Background

Timeless plays a role in DNA damage checkpoint responses. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMELESS