TIFA Antibody

Product Discontinued

TIFA Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIFA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TIFA Antibody

• Putative MAPK-activating protein PM14
• Putative NF-kappa-B-activating protein 20
• T2BPMGC20791
• T6BP
• TIFAA
• TRAF2 binding protein
• TRAF2-binding protein
• TRAF6 binding protein
• TRAF-interacting protein with a forkhead-associated domain
• TRAF-interacting protein with FHA domain-containing protein A
• TRAF-interacting protein with forkhead-associated domain

Background

Adapter protein which mediates the IRAK1 and TRAF6 interaction following IL-1 stimulation, resulting in thedownstream activation of NF-kappa-B and AP-1 pathways. Induces the oligomerization and polyubiquitination of TRAF6,which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIFA