THYN1 Antibody

Images

 
Western Blot: THYN1 Antibody [NBP2-32645] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEL
Immunocytochemistry/ Immunofluorescence: THYN1 Antibody [NBP2-32645] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli fibrillar center & cytosol.
Immunohistochemistry: THYN1 Antibody [NBP2-32645] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THYN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THYN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
THYN1 Protein (NBP2-32645PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for THYN1 Antibody

  • HSPC144
  • MDS012
  • MGC12187
  • THY28KD
  • THY28MY105
  • thymocyte nuclear protein 1
  • Thymocyte protein Thy28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81353
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001646-M03
Species: Hu
Applications: WB, ELISA
MAB17791
Species: Hu, Mu
Applications: WB
NB100-1573
Species: Hu
Applications: WB, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-32645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for THYN1 Antibody (NBP2-32645) (0)

There are no publications for THYN1 Antibody (NBP2-32645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THYN1 Antibody (NBP2-32645) (0)

There are no reviews for THYN1 Antibody (NBP2-32645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for THYN1 Antibody (NBP2-32645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THYN1 Products

Bioinformatics Tool for THYN1 Antibody (NBP2-32645)

Discover related pathways, diseases and genes to THYN1 Antibody (NBP2-32645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THYN1 Antibody (NBP2-32645)

Discover more about diseases related to THYN1 Antibody (NBP2-32645).
 

Pathways for THYN1 Antibody (NBP2-32645)

View related products by pathway.

Blogs on THYN1

There are no specific blogs for THYN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THYN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THYN1