| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4H7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse Thymosin beta 4 Antibody (4H7) - Azide and BSA Free (H00007114-M03-100ug) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-Thymosin beta 4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | TMSB4X (NP_066932, 1 a.a. ~ 44 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TMSB4X |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
| Publication using H00007114-M03-100ug | Applications | Species |
|---|---|---|
| Martin-Lorenzo M, Balluff B, Maroto A et al. Molecular anatomy of ascending aorta in atherosclerosis by MS Imaging: Specific lipid and protein patterns reflect pathology. J Proteomics. 2015-06-12 [PMID: 26079611] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Thymosin beta 4 Antibody (H00007114-M03-100ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.