Thioredoxin-like 5/TRP14/TXNDC17 Antibody - BSA Free

Western Blot: Thioredoxin-like 5/TRP14/TXNDC17 Antibody [NBP1-81204] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: Thioredoxin-like 5/TRP14/TXNDC17 Antibody [NBP1-81204] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thioredoxin-like 5/TRP14/TXNDC17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Thioredoxin-like 5/TRP14/TXNDC17 Antibody - BSA Free (NBP1-81204) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXNDC17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Thioredoxin-like 5/TRP14/TXNDC17 Protein (NBP1-81204PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Thioredoxin-like 5/TRP14/TXNDC17 Antibody - BSA Free

• MGC14353
• Protein 42-9-9
• thioredoxin (Trx)-related protein, 14 kDa
• thioredoxin domain containing 17
• thioredoxin domain-containing protein 17
• Thioredoxin like 5
• Thioredoxin-like 5
• Thioredoxin-like protein 5
• TRP14
• TRP1414 kDa thioredoxin-related protein
• TXNDC17
• TXNL5

Background

Disulfide reductase. May participate in various redox reactions through the reversible oxidation of itsactive center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signalingand NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TXNDC17
• Entrez:
  • 84817(Human)
• Uniprot:
  • Q9BRA2()
  • Q9BRA2()
  • Q9BRA2()
  • Q9BRA2()