Thioredoxin-1 Antibody - BSA Free

Western Blot: Thioredoxin Antibody [NBP2-48873] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-48873] - Staining of human cell line U-251 MG shows localization to nucleus and cytosol. Antibody staining is shown in greeen.

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human kidney.

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining in human esophagus and skeletal muscle tissues using anti-TXN antibody. Corresponding TXN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human colon, esophagus, kidney and skeletal muscle using Anti-TXN antibody NBP2-48873 (A) shows similar protein distribution across tissues to independent antibody NBP2-49191 (B).

Immunohistochemistry-Paraffin: Thioredoxin Antibody [NBP2-48873] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thioredoxin-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Thioredoxin Recombinant Protein Antigen (NBP2-48873PEP)

Reactivity Notes

Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Thioredoxin-1 Antibody - BSA Free

• Thioredoxin1
• Thioredoxin-1
• TRDX;TRX;TRX1;Trx80;TXN
• Trx1
• TXN
• TXN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Thioredoxin Antibody (NBP2-48873)(1)

Publication using NBP2-48873

• Souter P, Vaughan J, Butcher K, Dowle A et Al. Identification of mesenchymal stromal cell survival responses to antimicrobial silver ion concentrations released from orthopaedic implants Sci Rep 2020-11-04 [PMID: 33144664]

Bioinformatics

• Gene Symbol: TXN