Home » THAP1 » THAP1 Antibodies » THAP1 Antibody (2C1-2F2)

THAP1 Antibody (2C1-2F2)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: THAP1 Antibody (2C1-2F2) [H00055145-M01] - Analysis of THAP1 over-expressed 293 cell line, cotransfected with THAP1 Validated Chimera RNAi ( Cat # H00055145-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with THAP1 monoclonal antibody (M01), clone 2C1-2F2 (Cat # H00055145-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: THAP1 Antibody (2C1-2F2) [H00055145-M01] - Analysis of THAP1 over-expressed 293 cell line, cotransfected with THAP1 Validated Chimera RNAi ( Cat # H00055145-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Immunocytochemistry/ Immunofluorescence: THAP1 Antibody (2C1-2F2) [H00055145-M01] - Analysis of monoclonal antibody to THAP1 on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: THAP1 Antibody (2C1-2F2) [H00055145-M01] - Analysis of THAP1 expression in transfected 293T cell line by THAP1 monoclonal antibody (M01), clone 2C1-2F2.Lane 1: THAP1 transfected lysate(24.9 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, KD
Clone
2C1-2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

THAP1 Antibody (2C1-2F2) Summary

Immunogen
THAP1 (AAH21721, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Specificity
THAP1 - THAP domain containing, apoptosis associated protein 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
THAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi Validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for THAP1 Antibody (2C1-2F2)

  • 4833431A01Rik
  • dystonia 6, torsion (autosomal dominant)
  • DYT6
  • FLJ10477
  • MGC33014
  • nuclear proapoptotic factor
  • THAP domain containing, apoptosis associated protein 1
  • THAP domain protein 1
  • THAP domain-containing protein 1

Background

The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Torsin A Antibody
NBP3-03780
Immunohistochemistry-Paraffin: Torsin A Antibody [NBP3-03780] - Paraffin-embedded human normal breast using Torsin A antibody at dilution of 1:200 (40x lens).
Immunohistochemistry-Paraffin: Torsin A Antibody [NBP3-03780] - Paraffin-embedded rat liver using Torsin A antibody at dilution of 1:200 (40x lens).
Western Blot: Torsin A Antibody [NBP3-03780] - Analysis of extracts of various cell lines, using Torsin A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Flow Cytometry: Glut1 Antibody [NB110-39113] - An intracellular stain was performed on HepG2 with NB110-39113 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut1 Antibody [NB110-39113] - PrP-mediated increase in IC iron downregulates glucose transporters in the brain, neuroretina, and the liver: A similar evaluation of retinal lysates shows upregulation of Glut1 in PrP-/- relative to Tg40 PrP samples (lanes 1 & 3). Iron overloading downregulates Glut1 in Tg40 PrP samples relative to untreated controls, but has minimal effect on similarly treated PrP-/- samples (lanes 2 & 4). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/s41598-018-24786-1) licensed under a CC-BY licence.
(7 Reviews)
(48 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Sodium Potassium
ATPase Alpha 3 Antibo ...
NB300-540
Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) [NB300-540] - Analysis of Sodium/Potassium ATPase alpha-3 using Sodium/Potassium ATPase alpha-3 Monoclonal antibody (XVIF9-G10) shows staining in C6 glioma cells. Sodium/Potassium ATPase alpha-3 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Potassium ATPase alpha-3 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) [NB300-540] - Sodium/Potassium ATPase alpha-3 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) in HeLa cells is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Potassium ATPase alpha-3 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) [NB300-540] - Sodium/Potassium ATPase alpha-3 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) in U251 glioma cells is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Sodium/Potassium ATPase alpha-3 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Reviews)
(15 Publications)
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
GCH1 Antibody
NBP3-12307
Immunohistochemistry-Paraffin: GCH1 Antibody [NBP3-12307] - Mouse spleen. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 10X magnfication.
Immunohistochemistry-Paraffin: GCH1 Antibody [NBP3-12307] - Mouse spleen. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnfication.
Species: Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for PKR at approximately 73 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
PKR was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line stimulated with rhIFN-alpha (Catalog # 11110-1) using Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PKR at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(5 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB

epsilon-Sarcoglycan An
NBP1-59794
Immunohistochemistry: SGCE Antibody [NBP1-59794] - pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(173 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
KAT4/TBP
Associated Factor 1 A
NBP1-77847
Immunohistochemistry: KAT4/TBP Associated Factor 1 Antibody [NBP1-77847] - Tissue: prostate. Fixation: formalin fixed paraffin embedded. Primary antibody: Anti-TAF1 at 10 ug/mL for 1 h at RT. Secondary antibody: Peroxidase rabbit secondary antibody at 1:10,000 for 45 min at RT. Staining: TAF-1 as precipitated red signal with hematoxylin purple nuclear counterstain.
Chromatin Immunoprecipitation: KAT4/TBP Associated Factor 1 Antibody [NBP1-77847] - Chromatin Immunoprecipitation: KAT4/TBP Associated Factor 1 Antibody [NBP1-77847] Transcription Initiation Factor TFIID Subunit 1 (TAF1) antibody was used to detect TAF1 in treated and untreated HeLa Cells. HeLa cells were treated with TNF alpha and Chromatin was prepared by Chip Kit. CHIP was performed on fos promoters using 5 ug of TAF1 antibody and an RNA PolII antibody.
Western Blot: KAT4/TBP Associated Factor 1 Antibody [NBP1-77847] - HeLa nuclear extract (arrowhead). The membrane was probed with the primary antibody at dilutions of 1:100 (lane 1), 1:250 (lane 2), 1: 500 (Lane 3 and 1:1,000 (Lane 4). The identity of the bands at ~95 kDa is unknown, but may be degraded TAF1. Personal Communication, Anne Gegonne, CCR-NCI, Bethesda, MD.
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - U2OS cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.1% Saponin. The cells were incubated with anti-LRP2 (CD7D5) at 20 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: LRP2 Antibody (CD7D5) [NB110-96417] - Representative immunofluorescence stainings of control (Tead4m-z+) and Tead4 maternal/zygotic mutant (Tead4m-z-) embryos for Krt8 and Krt18 (16 cell stage embryos) and Lrp2 and Dab2 (32 to 64 cell stage embryos; Lrp2 and Dab2 were not detected in earlier stage embryos). n indicates total number of embryos analyzed. Scale bar: 25 um. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/22906), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Analysis of a FFPE tissue section of mouse kidney using 1:200 dilution of LRP2 [CD7D5] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MCF2L Antibody
(1D11)
H00023263-M01
Sandwich ELISA: MCF2L Antibody (1D11) [H00023263-M01] - Detection limit for recombinant GST tagged MCF2L is approximately 0.03ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: MCF2L Antibody (1D11) [H00023263-M01] - Analysis of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
PNKD Antibody
NBP1-88347
Western Blot: PNKD Antibody [NBP1-88347] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PNKD antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PNKD Antibody [NBP1-88347] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PNKD Antibody [NBP1-88347] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
PML Protein
Antibody - BSA Free
NB100-59787
Western Blot: PML Protein Antibody [NB100-59787] - PML-RARa is a HIF-I+-transcriptional co-activator. HEK-293 cells transfected with stable mutants of HIF-1I+-or HIF-2I+-and increasing concentrations of PML-RARI+-. Image collected and cropped by Citeab from the following publication (HIF factors cooperate with PML-RAR +/- to promote acute promyelocytic leukemia progression and relapse. EMBO Mol Med (2014)) licensed under a CC-BY licence.
Immunohistochemistry: PML Protein Antibody [NB100-59787] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti- PML used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Immunocytochemistry/Immunofluorescence: PML Protein Antibody - BSA Free [NB100-59787] - A431 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with PML Protein Antibody (NB100-59787) at 1ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(1 Review)
(34 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB

CAMP/LL37/FALL39/Cathe ...
NBP1-76864
Immunohistochemistry-Paraffin: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - IHC analysis of a formalin fixed paraffin embedded tissue section of human lymph node using 5 ug/ml dilution of CAMP antibody (NBP1-76864). The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin.
Western Blot: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - Human spleen tissue lysate with Cathelicidin antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - in Human Spleen cells.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RRM1 Antibody
NBP2-20231
Western Blot: RRM1 Antibody [NBP2-20231] - A. 30 ug NIH-3T3 whole cell lysate/extract B. 30 ug Raw264. 7 whole cell lysate/extract C. 30 ug C2C12 whole cell lysate/extract5 % SDS-PAGE RRM1 antibody dilution: 1:1000.
Western Blot: RRM1 Antibody [NBP2-20231] - Sample (30 ug of whole cell lysate) A: 293T 5% SDS PAGE gel, diluted at 1:2000.
Immunohistochemistry-Paraffin: RRM1 Antibody [NBP2-20231] - Human colon carcinoma, using RRM1 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Host Cell Factor
1/HCFC1 Antibody
NB100-68210
Simple Western: Host Cell Factor 1/HCFC1 Antibody [NB100-68210] - Transcriptional activation by E2F4 in mouse ES cells is mediated by chromatin modifiers. Validation of interactions between GFP-E2F4 and DP-1, Host Cell Factor 1/HCFC1, YEATS2, LIN54, and LIN9, by co-immunoprecipitation followed by immunoassay, in mouse ES cells and human RPE cells. Transcriptional activators (Host Cell Factor 1/HCFC1 and YEATS2) preferentially bind to E2F4 in mouse ES cells while members of the DREAM repressor complex (LIN54 and LIN9) bind preferentially to E2F4 in RPE cells. Molecular weights (kDa) are indicated on the left side (one experiment shown of at least two experiments) Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-10901-x), licensed under a CC-BY licence.
Western Blot: Host Cell Factor 1/HCFC1 Antibody [NB100-68210] - Detection of Human HCF1 on HeLa whole cell lysate using 100-68210. HCF1 was also immunoprecipitated by rabbit anti-HCF1 antibody NB100-68209.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
RB1 Antibody
(172C1094) - (cleaved
NB100-56598
Knockdown Validated: RB1 Antibody (172C1094) - (cleaved) [NB100-56598] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and RB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human RB-1 Monoclonal Antibody (Catalog # NB100-56598) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for RB-1 at approximately 60 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
E2F6 Antibody
(1F7-A9)
H00001876-M02
Sandwich ELISA: E2F6 Antibody (1F7-A9) [H00001876-M02] - Detection limit for recombinant GST tagged E2F6 is approximately 0.03ng/ml as a capture antibody.
Western Blot: E2F6 Antibody (1F7-A9) [H00001876-M02] - Western Blot analysis of E2F6 expression in PC-12(Cat # L012V1 ).
Western Blot: E2F6 Antibody (1F7-A9) [H00001876-M02] - Western Blot analysis of E2F6 expression in HepG2 ( Cat # L019V1 ).
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
CIZ1 Antibody
NB100-74624
Western Blot: CIZ1 Antibody [NB100-74624] - Detection of Human CIZ1on HeLa whole cell lysate using NB100-74624. CIZ1 was also immunoprecipitated by rabbit anti-CIZ1 antibody NB100-74623.
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB

Publications for THAP1 Antibody (H00055145-M01) (0)

There are no publications for THAP1 Antibody (H00055145-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THAP1 Antibody (H00055145-M01) (0)

There are no reviews for THAP1 Antibody (H00055145-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for THAP1 Antibody (H00055145-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THAP1 Products

Bioinformatics Tool for THAP1 Antibody (H00055145-M01)

Discover related pathways, diseases and genes to THAP1 Antibody (H00055145-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THAP1 Antibody (H00055145-M01)

Discover more about diseases related to THAP1 Antibody (H00055145-M01).
 

Pathways for THAP1 Antibody (H00055145-M01)

View related products by pathway.

Research Areas for THAP1 Antibody (H00055145-M01)

Find related products by research area.

Blogs on THAP1

There are no specific blogs for THAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THAP1 Antibody (2C1-2F2) and receive a gift card or discount.


Bioinformatics

Gene Symbol THAP1
Entrez
OMIM
Uniprot