TGIF1 Recombinant Protein Antigen

Images

 
There are currently no images for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TGIF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGIF1.

Source: E. coli

Amino Acid Sequence: SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TGIF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55829.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TGIF1 Recombinant Protein Antigen

  • 5'-TG-3' interacting factor
  • homeobox protein TGIF
  • homeobox protein TGIF1
  • HPE4
  • MGC39747
  • TALE homeobox TG-interacting factor
  • TGFB-induced factor (TALE family homeobox)
  • TGFB-induced factor homeobox 1
  • TGIF1
  • TGIFMGC5066,5'-TG-3'-interacting factor 1
  • transforming growth factor-beta-induced factor

Background

Novel homeobox gene, denoted TGIF (interacting factor), belongs to an expanding TALE (three amino acid loop extension) superclass of atypical homeodomains. The TGIF homeodomain binds to a previously characterized retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE), which contains an unusual DNA target for a homeobox (1). In vitro studies have implicated TGIF as a transcriptional repressor and corepressor in retinoid and TGF-beta signaling pathways that regulate several important biological processes. Heterozygous nonsense and missense mutations of the human TGIF gene have been associated with holoprosencephaly, the most common congenital malformation of the forebrain (2). It has been reported that TGIF plays an unexpected role in the inhibition of Smad2 phosphorylation, which occurs by a mechanism independent of its association with Smad2. This inhibitory function of TGIF is executed in concert with c-Jun, which facilitates the interaction of TGIF with cPML, resulting in the nuclear sequestration of cPML and the disruption of the cPML-SARA complex (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP2-24607
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00060436-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03881
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
294-HG
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
AF3635
Species: Mu
Applications: IHC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB41051
Species: Hu, Mu
Applications: WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
AF4248
Species: Hu
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-55829PEP
Species: Hu
Applications: AC

Publications for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP) (0)

There are no publications for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP) (0)

There are no reviews for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGIF1 Products

Research Areas for TGIF1 Recombinant Protein Antigen (NBP2-55829PEP)

Find related products by research area.

Blogs on TGIF1

There are no specific blogs for TGIF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TGIF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TGIF1