TFIISH Antibody

Images

 
Western Blot: TFIISH Antibody [NBP1-91318] - Mouse Thymus Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIISH Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence LKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIRE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Tcea3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TFIISH Antibody

  • rhabdomyosarcoma antigen MU-RMS-40.22
  • TFIIS
  • TFIIS.H
  • TFIISH
  • transcription elongation factor A (SII), 3
  • transcription elongation factor A protein 3
  • Transcription elongation factor S-II protein 3
  • Transcription elongation factor TFIIS.h

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-273
Species: Hu, Mu, Rt
Applications: WB
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-49349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
H00009441-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TFIISH Antibody (NBP1-91318) (0)

There are no publications for TFIISH Antibody (NBP1-91318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIISH Antibody (NBP1-91318) (0)

There are no reviews for TFIISH Antibody (NBP1-91318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFIISH Antibody (NBP1-91318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIISH Products

Bioinformatics Tool for TFIISH Antibody (NBP1-91318)

Discover related pathways, diseases and genes to TFIISH Antibody (NBP1-91318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TFIISH Antibody (NBP1-91318)

View related products by pathway.

Blogs on TFIISH

There are no specific blogs for TFIISH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIISH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEA3
Uniprot