TFIIS Antibody

Images

 
Immunohistochemistry-Paraffin: TFIIS Antibody [NBP2-13418] - Staining of human breast shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIIS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
TFIIS Protein (NBP2-13418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFIIS Antibody

  • Testis-specific S-II
  • TFIIS
  • transcription elongation factor A (SII), 2
  • transcription elongation factor A protein 2
  • Transcription elongation factor S-II protein 2
  • transcription elongation factor TFIIS.1
  • Transcription elongation factor TFIIS.l

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-273
Species: Hu, Mu, Rt
Applications: WB
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-49349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
H00009441-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TFIIS Antibody (NBP2-13418) (0)

There are no publications for TFIIS Antibody (NBP2-13418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIS Antibody (NBP2-13418) (0)

There are no reviews for TFIIS Antibody (NBP2-13418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TFIIS Antibody (NBP2-13418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIIS Products

Bioinformatics Tool for TFIIS Antibody (NBP2-13418)

Discover related pathways, diseases and genes to TFIIS Antibody (NBP2-13418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIS Antibody (NBP2-13418)

Discover more about diseases related to TFIIS Antibody (NBP2-13418).
 

Pathways for TFIIS Antibody (NBP2-13418)

View related products by pathway.

PTMs for TFIIS Antibody (NBP2-13418)

Learn more about PTMs related to TFIIS Antibody (NBP2-13418).

Blogs on TFIIS

There are no specific blogs for TFIIS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEA2