TFF3 Antibody (3H7)


Sandwich ELISA: TFF3 Antibody (3H7) [H00007033-M03] - Detection limit for recombinant GST tagged TFF3 is 0.1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA

Order Details

TFF3 Antibody (3H7) Summary

TFF3 (AAH17859.1, 15 a.a. - 73 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
TFF3 - trefoil factor 3 (intestinal)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFF3 Antibody (3H7)

  • HITF, human intestinal trefoil factor10Intestinal trefoil factor
  • ITF
  • TFF3
  • TFI
  • trefoil factor 3 (intestinal)


Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for TFF3 Antibody (H00007033-M03) (0)

There are no publications for TFF3 Antibody (H00007033-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFF3 Antibody (H00007033-M03) (0)

There are no reviews for TFF3 Antibody (H00007033-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TFF3 Antibody (H00007033-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TFF3 Products

Bioinformatics Tool for TFF3 Antibody (H00007033-M03)

Discover related pathways, diseases and genes to TFF3 Antibody (H00007033-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFF3 Antibody (H00007033-M03)

Discover more about diseases related to TFF3 Antibody (H00007033-M03).

Pathways for TFF3 Antibody (H00007033-M03)

View related products by pathway.

PTMs for TFF3 Antibody (H00007033-M03)

Learn more about PTMs related to TFF3 Antibody (H00007033-M03).

Research Areas for TFF3 Antibody (H00007033-M03)

Find related products by research area.

Blogs on TFF3

There are no specific blogs for TFF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TFF3 Antibody (3H7) and receive a gift card or discount.


Gene Symbol TFF3