TFCP2 Antibody (3H6) - Azide and BSA Free

Western Blot: TFCP2 Antibody (3H6) [H00007024-M01] - Analysis of TFCP2 expression in transfected 293T cell line by TFCP2 monoclonal antibody (M01), clone 3H6.Lane 1: TFCP2 transfected lysate(57.3 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: TFCP2 Antibody (3H6) [H00007024-M01] - Detection limit for recombinant GST tagged TFCP2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TFCP2 Antibody (3H6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TFCP2 (AAH03634, 414 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK
• Specificity: TFCP2 - transcription factor CP2
• Isotype: IgG2a Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: TFCP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFCP2 Antibody (3H6) - Azide and BSA Free

• alpha-globin transcription factor CP2
• CP2
• LBP-1C
• LSF1D
• LSFLBP1C
• SAA3 enhancer factor
• SEF
• TFCP2C
• transcription factor CP2
• Transcription factor LSF

Background

CP2c binds a variety of cellular and viral promoters including fibrinogen, alpha-globin, SV40 and HIV-1 promoters. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with UBP1 . Functions as part of the SSP (stage selecto

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFCP2
• Entrez:
  • 7024(Human)
• OMIM:
  • 189889(Human)
• Uniprot:
  • AAH03634(Human)