TFAP4 Antibody (7A10)

Images

 
Western Blot: TFAP4 Antibody (7A10) [H00007023-M03] - Analysis of TFAP4 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: TFAP4 Antibody (7A10) [H00007023-M03] - Analysis of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1 ug/ml
Western Blot: TFAP4 Antibody (7A10) [H00007023-M03] - Analysis of TFAP4 over-expressed 293 cell line, cotransfected with TFAP4 Validated Chimera RNAi (Cat # H00007023-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TFAP4 Antibody (7A10) [H00007023-M03] - Analysis of TFAP4 expression in transfected 293T cell line by TFAP4 monoclonal antibody (M03), clone 7A10. Lane 1: TFAP4 transfected lysatE (38.7 KDa). Lane 2: ...read more
ELISA: TFAP4 Antibody (7A10) [H00007023-M03] - Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
7A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TFAP4 Antibody (7A10) Summary

Immunogen
TFAP4 (NP_003214, 93 a.a. - 192 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Specificity
TFAP4 (7A10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TFAP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFAP4 Antibody (7A10)

  • Activating enhancer-binding protein 4
  • AP-4
  • BHLHC41
  • bHLHc41Class C basic helix-loop-helix protein 41
  • transcription factor AP-4 (activating enhancer binding protein 4)
  • transcription factor AP-4 (activating enhancer-binding protein 4)
  • transcription factor AP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
AF6116
Species: Hu
Applications: WB, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NBP2-56456
Species: Hu
Applications: ICC/IF, IHC-P

Publications for TFAP4 Antibody (H00007023-M03) (0)

There are no publications for TFAP4 Antibody (H00007023-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFAP4 Antibody (H00007023-M03) (0)

There are no reviews for TFAP4 Antibody (H00007023-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFAP4 Antibody (H00007023-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFAP4 Products

Bioinformatics Tool for TFAP4 Antibody (H00007023-M03)

Discover related pathways, diseases and genes to TFAP4 Antibody (H00007023-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFAP4 Antibody (H00007023-M03)

Discover more about diseases related to TFAP4 Antibody (H00007023-M03).
 

Pathways for TFAP4 Antibody (H00007023-M03)

View related products by pathway.

PTMs for TFAP4 Antibody (H00007023-M03)

Learn more about PTMs related to TFAP4 Antibody (H00007023-M03).

Blogs on TFAP4

There are no specific blogs for TFAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFAP4 Antibody (7A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP4
Entrez
OMIM
Uniprot