TFAP2D Antibody


Western Blot: TFAP2D Antibody [NBP2-13428] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TFAP2D Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRK TSEAAVKEGK
Specificity of human, mouse, rat TFAP2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFAP2D Protein (NBP2-13428PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TFAP2D Antibody

  • Activating enhancer-binding protein 2-delta
  • AP-2 like
  • AP2-delta
  • TFAP2BL1activating enhancer binding protein 2 beta-like 1
  • transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1
  • transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1
  • transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
  • Transcription factor AP-2-beta-like 1
  • transcription factor AP-2-delta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TFAP2D Antibody (NBP2-13428) (0)

There are no publications for TFAP2D Antibody (NBP2-13428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFAP2D Antibody (NBP2-13428) (0)

There are no reviews for TFAP2D Antibody (NBP2-13428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFAP2D Antibody (NBP2-13428). (Showing 1 - 1 of 1 FAQ).

  1. Have any of your TFAP2 antibodies been tested for cross reactivity with the other TFAP2 proteins such as alpha, beta and epsilon? Have they been tested by immunostaining tissue?
    • A list of our TFAP2D antibodies can be found here. Our products are all guaranteed for the applications and species listed on the datasheet and are not expected to cross-react with any known proteins.

Secondary Antibodies


Isotype Controls

Additional TFAP2D Products

Bioinformatics Tool for TFAP2D Antibody (NBP2-13428)

Discover related pathways, diseases and genes to TFAP2D Antibody (NBP2-13428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFAP2D Antibody (NBP2-13428)

Discover more about diseases related to TFAP2D Antibody (NBP2-13428).

Pathways for TFAP2D Antibody (NBP2-13428)

View related products by pathway.

Blogs on TFAP2D

There are no specific blogs for TFAP2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TFAP2D Antibody and receive a gift card or discount.


Gene Symbol TFAP2D