TFAP2D Antibody - BSA Free

Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFAP2D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFAP2D Antibody - BSA Free (NBP2-13428) is a polyclonal antibody validated for use in IHC. Anti-TFAP2D Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAP2D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TFAP2D Protein (NBP2-13428PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TFAP2D Antibody - BSA Free

• Activating enhancer-binding protein 2-delta
• AP-2 like
• AP2-delta
• TFAP2BL1activating enhancer binding protein 2 beta-like 1
• transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1
• transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1
• transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
• Transcription factor AP-2-beta-like 1
• transcription factor AP-2-delta

Background

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements toregulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activategenes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb andneural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TFAP2D Antibody (NBP2-13428)(1)

Publication using NBP2-13428

• Barzago MM, Kurosaki M, Fratelli M et al. Generation of a new mouse model of glaucoma characterized by reduced expression of the AP-2B and AP-2d proteins Sci Rep 2017-09-11 [PMID: 28894266]

FAQs for TFAP2D Antibody (NBP2-13428). (Showing 1 - 1 of 1 FAQ).

1. Have any of your TFAP2 antibodies been tested for cross reactivity with the other TFAP2 proteins such as alpha, beta and epsilon? Have they been tested by immunostaining tissue?
   • A list of our TFAP2D antibodies can be found here. Our products are all guaranteed for the applications and species listed on the datasheet and are not expected to cross-react with any known proteins.

Bioinformatics

• Gene Symbol: TFAP2D