TEX35 Antibody

Images

 
Western Blot: C1orf49 Antibody [NBP1-90530] - Analysis in control (vector only transfected HEK293T lysate) and TEX35 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: C1orf49 Antibody [NBP1-90530] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEX35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRP
Specificity
Specificity of human C1orf49 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX35 Recombinant Protein Antigen (NBP1-90530PEP)
Publications
Read Publication using NBP1-90530.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEX35 Antibody

  • C1orf49
  • chromosome 1 open reading frame 49
  • DKFZp564J047
  • RP5-990P15.1
  • testis expressed 35
  • TSC24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2777
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1235
Species: Hu
Applications: WB, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF5480
Species: Hu
Applications: IHC
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF
NBP1-03020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-88042
Species: Hu
Applications: IHC, IHC-P
H00004595-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP1-84645
Species: Hu
Applications: WB, IHC, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP2-27543
Species: Hu
Applications: WB, PEP-ELISA
NBP2-49215
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP3-05619
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90530
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEX35 Antibody (NBP1-90530)(1)

Reviews for TEX35 Antibody (NBP1-90530) (0)

There are no reviews for TEX35 Antibody (NBP1-90530). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX35 Antibody (NBP1-90530) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TEX35 Products

Bioinformatics Tool for TEX35 Antibody (NBP1-90530)

Discover related pathways, diseases and genes to TEX35 Antibody (NBP1-90530). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TEX35 Antibody (NBP1-90530)

View related products by pathway.

Blogs on TEX35

There are no specific blogs for TEX35, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX35