RALGPS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining in human testis and pancreas tissues using anti-RALGPS2 antibody. Corresponding RALGPS2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human colon, liver, lymph node and testis using Anti-RALGPS2 antibody NBP1-84645 (A) shows similar protein distribution across tissues to independent antibody NBP1-84646 (B).

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human liver.

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human colon.

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human lymph node.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RALGPS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RALGPS2 Antibody - BSA Free (NBP1-84645) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STLSSGISIGSSDGSELSEETSWPAFERNRLYHSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLR
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RALGPS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RALGPS2 Protein (NBP1-84645PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RALGPS2 Antibody - BSA Free

• dJ595C2.1
• FLJ10244
• FLJ25604
• KIAA0351
• Ral GEF with PH domain and SH3 binding motif 2
• Ral GEF with PH domain and SH3-binding motif 2
• RalA exchange factor RalGPS2
• Ral-A exchange factor RalGPS2
• ras-specific guanine nucleotide-releasing factor RalGPS2

Background

Guanine nucleotide exchange factor for the small GTPase RALA. May be involved in cytoskeletal organization. May also be involved in the stimulation of transcription in a Ras-independent fashion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RALGPS2