TEX13A Antibody

Images

 
Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Analysis in human testis and endometrium tissues using Anti-TEX13A antibody. Corresponding TEX13A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human endometrium shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEX13A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX13A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX13A Recombinant Protein Antigen (NBP2-62675PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TEX13A Antibody

  • MGC131984
  • testis expressed 13A
  • testis expressed sequence 13A
  • testis-expressed sequence 13A protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80691
Species: Hu
Applications: IHC, IHC-P
NBP1-59482
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80698
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-13754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84951
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00009406-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for TEX13A Antibody (NBP2-62675) (0)

There are no publications for TEX13A Antibody (NBP2-62675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX13A Antibody (NBP2-62675) (0)

There are no reviews for TEX13A Antibody (NBP2-62675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TEX13A Antibody (NBP2-62675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TEX13A Antibody (NBP2-62675)

Discover related pathways, diseases and genes to TEX13A Antibody (NBP2-62675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX13A Antibody (NBP2-62675)

Discover more about diseases related to TEX13A Antibody (NBP2-62675).
 

Pathways for TEX13A Antibody (NBP2-62675)

View related products by pathway.

Blogs on TEX13A

There are no specific blogs for TEX13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX13A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX13A