TEX13A Antibody


Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Analysis in human testis and endometrium tissues using Anti-TEX13A antibody. Corresponding TEX13A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human endometrium shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TEX13A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDC
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX13A Recombinant Protein Antigen (NBP2-62675PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for TEX13A Antibody

  • MGC131984
  • testis expressed 13A
  • testis expressed sequence 13A
  • testis-expressed sequence 13A protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for TEX13A Antibody (NBP2-62675) (0)

There are no publications for TEX13A Antibody (NBP2-62675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX13A Antibody (NBP2-62675) (0)

There are no reviews for TEX13A Antibody (NBP2-62675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TEX13A Antibody (NBP2-62675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TEX13A Antibody (NBP2-62675)

Discover related pathways, diseases and genes to TEX13A Antibody (NBP2-62675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX13A Antibody (NBP2-62675)

Discover more about diseases related to TEX13A Antibody (NBP2-62675).

Pathways for TEX13A Antibody (NBP2-62675)

View related products by pathway.

Blogs on TEX13A

There are no specific blogs for TEX13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TEX13A Antibody and receive a gift card or discount.


Gene Symbol TEX13A