![Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/TEX13A-Antibody-Immunohistochemistry-Paraffin-NBP2-62675-img0002.jpg "Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human testis shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TEX13A Antibody - BSA Free (NBP2-62675) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TEX13A |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TEX13A |
![Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Analysis in human testis and endometrium tissues using Anti-TEX13A antibody. Corresponding TEX13A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TEX13A-Antibody-Immunohistochemistry-Paraffin-NBP2-62675-img0001.jpg "Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Analysis in human testis and endometrium tissues using Anti-TEX13A antibody. Corresponding TEX13A RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/TEX13A-Antibody-Immunohistochemistry-Paraffin-NBP2-62675-img0003.jpg "Immunohistochemistry-Paraffin: TEX13A Antibody [NBP2-62675] - Staining of human endometrium shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")