Testican 2/SPOCK2 Antibody - BSA Free

Western Blot: Testican 2/SPOCK2 Antibody [NBP1-92442] - Analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Testican 2/SPOCK2 Antibody [NBP1-92442] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Testican 2/SPOCK2 Antibody [NBP1-92442] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Testican 2/SPOCK2 Antibody [NBP1-92442] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Testican 2/SPOCK2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPOCK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Testican 2/SPOCK2 Protein (NBP1-92442PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Testican 2/SPOCK2 Antibody - BSA Free

• FLJ97039
• KIAA0275
• KIAA0275CWCV, and Kazal-like domains proteoglycan 2
• sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
• SPOCK2
• Testican 2

Background

Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK2 encodes a member of a novel Ca(2+)-binding proteoglycan family.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPOCK2