TSSK1 Antibody - BSA Free

Western Blot: TSSK1 Antibody [NBP1-83883] - Analysis in control (vector only transfected HEK293T lysate) and TSSK1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TSSK1 Antibody [NBP1-83883] - Staining in human testis and endometrium tissues using anti-TSSK1B antibody. Corresponding TSSK1B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TSSK1 Antibody [NBP1-83883] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: TSSK1 Antibody [NBP1-83883] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSSK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSSK1 Antibody - BSA Free (NBP1-83883) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSSK1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TSSK1 Protein (NBP1-83883PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSSK1 Antibody - BSA Free

• EC 2.7.11
• serine/threonine kinase 22D (spermiogenesis associated)
• Serine/threonine-protein kinase 22A
• spermiogenesis associated 4
• SPOGA1
• SPOGA4EC 2.7.11.1
• STK22A
• STK22DFKSG81
• Testis-specific kinase 1
• testis-specific serine kinase 1
• testis-specific serine kinase 1B
• testis-specific serine/threonine-protein kinase 1
• TSK-1
• TSSK-1
• TSSK1serine/threonine kinase FKSG81

Background

TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSSK1B