Teneurin-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Teneurin-2 Antibody [NBP2-55763] - Staining of human cell line RH-30 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Teneurin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLGTTIG
Specificity
Specificity of human Teneurin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TENM2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western Blot reported in scientific literature (PMID:31928845).
Control Peptide
Teneurin-2 Recombinant Protein Antigen (NBP2-55763PEP)
Publications
Read Publication using
NBP2-55763 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31928845).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Teneurin-2 Antibody

  • teneurin-2
  • ODZ2
  • Ten-2
  • Tenascin-M2
  • teneurin transmembrane protein 2
  • Teneurin2
  • Teneurin-2
  • Ten-m2
  • TNM2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010178-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-81974
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-65543
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00003836-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
AF6320
Species: Hu, Mu, Rt
Applications: WB
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-31768
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-50509
Species: Hu
Applications: WB, IHC, IP
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Teneurin-2 Antibody (NBP2-55763)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Teneurin-2 Antibody (NBP2-55763) (0)

There are no reviews for Teneurin-2 Antibody (NBP2-55763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Teneurin-2 Antibody (NBP2-55763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Teneurin-2 Products

Bioinformatics Tool for Teneurin-2 Antibody (NBP2-55763)

Discover related pathways, diseases and genes to Teneurin-2 Antibody (NBP2-55763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Teneurin-2

There are no specific blogs for Teneurin-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Teneurin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TENM2