Tenascin C Recombinant Protein Antigen

Images

 
There are currently no images for Tenascin C Protein (NBP1-89639PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tenascin C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNC.

Source: E. coli

Amino Acid Sequence: RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89639.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tenascin C Recombinant Protein Antigen

  • 150-225
  • Cytotactin
  • Glioma-associated-extracellular matrix antigen
  • GMEM
  • GP 150-225
  • hexabrachion (tenascin C, cytotactin)
  • hexabrachion (tenascin)
  • Hexabrachion
  • HXB
  • HXBcytotactin
  • JI
  • MGC167029
  • Myotendinous antigen
  • neuronectin
  • Tenascin C
  • Tenascin J1
  • tenascin
  • tenascin-C isoform 14/AD1/16
  • Tenascin-C
  • TNC
  • TN-C
  • TNGP

Background

Tenascin, also known as hexabrachion and cytotactin, is an extracellular matrix protein with a spatially and temporally restricted tissue distribution. It is a hexameric, multidomain protein with disulfide linked subunits of 190 to 240 kD, originally characterized as 'myotendinous antigen.' In the embryo it is present in dense mesenchyme surrounding developing epithelia and in developing cartilage and bone. In the adult, tenascin remains present in tendons and myotendinous junctions in the perichondrium and periosteum, as well as in smooth muscle. Tenascin (TN)(Erickson and Bourdon 1989, Erickson 1993) is a high molecular weight, multifunctional, extracellular matrix glycoprotein, expressed in association with mesenchymal-epithelial interactions during development and in the neovasculature and stroma of undifferentiated tumors. It has been described under a variety of names: cytotactin, hexabrachion protein, J1-200/220, myotendinous antigen (MI), neuronectin (NEC1) and glioma mesenchymal extracellular matrix (GMEM). The TN molecule is a disulfide-linked hexamer. Human TN has 3 subunits of 190, 200 and 220 kDa. It is primarily made up of 14.5 epidermal growth-factor-like repeats, 15 units similar to the fibronectin type-III-homology repeat and, at the C-terminus, has a sequence with homology to the globular domain of the beta and gamma chain of fibrinogen. Monoclonal antibody reacting specifically with tenascin is an essential tool for the localization, identification and studies on the role of the molecule in epithelial-mesenchymal and neuronal-glial interactions (Castellucci et al. 1991, Balza et al. 1993).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP1-28872
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
137-PS
Species: Hu
Applications: BA
AF6999
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3627
Species: Hu
Applications: WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for Tenascin C Protein (NBP1-89639PEP) (0)

There are no publications for Tenascin C Protein (NBP1-89639PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tenascin C Protein (NBP1-89639PEP) (0)

There are no reviews for Tenascin C Protein (NBP1-89639PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tenascin C Protein (NBP1-89639PEP). (Showing 1 - 1 of 1 FAQ).

  1. One of our clients is looking for antibodies against tenascin C and fibronectin that could be used for FFPE rat tissues. These antibodies should exclusively recognize tenascin C and fibronectin and do not cross react with each other. Can you inform me if you have these antibodies?
    • Here is a link to Tenascin C antibodies we have validated in rat tissues for IHC-P Here are antibodies we have validated in fibronectin in rat tissues for IHC-P

Additional Tenascin C Products

Research Areas for Tenascin C Protein (NBP1-89639PEP)

Find related products by research area.

Blogs on Tenascin C

There are no specific blogs for Tenascin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tenascin C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNC