Home » TEM8/ANTXR1 » TEM8/ANTXR1 Proteins » Recombinant Human TEM8/ANTXR1 Protein

Recombinant Human TEM8/ANTXR1 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human TEM8/ANTXR1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-305 of Human TEM8/ANTXR1

Source: Wheat Germ

Amino Acid Sequence: VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSF
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ANTXR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TEM8/ANTXR1 Protein

  • anthrax toxin receptor 1
  • ANTXR1
  • ATR2310008J16Rik
  • FLJ10601
  • FLJ11298
  • FLJ21776
  • TEM8
  • TEM82810405N18Rik
  • Tumor endothelial marker 8

Background

The protein encoded by this gene is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. This protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104. (30 sec. exposure)
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton-X100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
(2 Reviews)
(79 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Chk1 Antibody
NB100-464
Western Blot: Chk1 Antibody [NB100-464] - Detection of Human Chk1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, and mouse TMCK cells. Antibodies: Affinity purified rabbit anti-Chk1 antibody NB100-464 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: Chk1 Antibody [NB100-464] - NBF-fixed HeLa cells treated with neocarzinostatin. Antibody used at a dilution of 1:1,000 (1ug/ml).
Immunohistochemistry: Chk1 Antibody [NB100-464] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-CHK1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(6 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Analysis using Azide Free version of NB100-56546. Chk2 in A) human HEK293 and B) mouse NIH3T3 lysate using Chk2 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: Chk2 Antibody (73C175.1.1) [NB100-56546] - Analysis using Azide Free version of NB100-56546. Staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - analysis of Chk2 in A) human HEK293 and B) mouse NIH3T3 lysate using Chk2 antibody at 2 ug/ml.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
gamma H2AX [p
Ser139] Antibody
NB100-384
Immunocytochemistry/Immunofluorescence: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Neocarzinostatin treated asynchronous HeLa cells (left) and untreated asynchronous HeLa cells (right). Antibody: Affinity purified rabbit anti-gamma-H2AX used at a dilution of 1:5,000 (0.2ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight 594 used at a dilution of 1:100.
Flow Cytometry: gamma H2AX [p Ser139] Antibody [NB100-384] - Analysis of gamma-H2AX in Etoposide Treated Jurkat Cells. Cells were treated for 3 hrs in 5ug/ml etoposide, fixed in 1.5% PFA, and permeabilized in 90% Methanol. 1 million cells were stained with 0.5 ug anti-KLH or anti-H2AX NB100-384 and secondary FITC-conjugated goat anti-rabbit (in a 150ul reaction). Black- etosposide treated, anti-KLH; Red- untreated, anti-gamma H2AX; Blue- etoposide treated, anti-gamma H2AX.
Western Blot: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Nuclear extract from HeLa cells treated with 100 uM etoposide for 4 hours (+) or mock treated (-). Antibody: Affinity purified rabbit anti-gamma-H2AX antibody used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(67 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CMG-2/ANTXR2
Antibody [Unconjugate
AF2940
Human whole blood monocytes were stained with Human CMG‑2/ANTXR2 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2940, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Nbs1 Antibody
NB100-143
Western Blot: Nbs1 Antibody [NB100-143] - TIG-1 human primary fibroblasts, whole cell lysate (30 ug). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Nbs1 Antibody [NB100-143] - Hela cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Nbs1 Antibody [NB100-143] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human testis using Nbs1 antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
(8 Reviews)
(157 Publications)
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
BRCA1 Antibody
(RAY)
NB100-598
Western Blot: BRCA1 Antibody (RAY) [NB100-598] - Analysis of BRCA1 on MCF7 lysate.
Immunocytochemistry/Immunofluorescence: BRCA1 Antibody (RAY) [NB100-598] - BRCA (RAY) antibody was tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Flow Cytometry: BRCA1 Antibody (RAY) [NB100-598] - Intracellular flow cytometric staining of 1 x 10^6 MCF-7 cells using BRCA1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(4 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
DNA-PKcs Antibody
(3H6)
NBP2-22128
Western Blot: DNA PKcs Antibody (3H6) [NBP2-22128] - Western blot image of DNA PKcs. HeLa (lane A), MCF7 (lane B) and HEK293 (lane C) whole cell protein was separated by SDS-PAGE on 6% gel, transferred to PVDF and probed with NBP2-22128. A single band of DNA PKcs reactivity at approximately 460 kDa was detected in all lysates.
Immunocytochemistry/Immunofluorescence: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunofluorescence analysis of Hela cells using DNA PKcs mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunohistochemical analysis of paraffin-embedded lung cancer (left) and brain tissues (right) using DNA PKcs mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Recombinant Human
PRH2 Protein
H00005555-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Mre11 Antibody
NB100-142
Western Blot: Mre11 Antibody [NB100-142] - Analysis of Mre11 on 50 ug of HeLa and MEF lysates, using NB100-142.
Immunocytochemistry/Immunofluorescence: Mre11 Antibody [NB100-142] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Mre11 [NB100-142] at a 1:500 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: Mre11 Antibody [NB100-142] - Staining of MRE11 in a human epidermis cross section.
(4 Reviews)
(152 Publications)
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pallidin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pallidin.
Immunohistochemistry-Paraffin: Pallidin Antibody (1H9) [NBP2-01763] - Staining of paraffin-embedded Human tonsil using anti-Pallidin mouse monoclonal antibody.
Flow Cytometry: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Pallidin antibody, and then analyzed by flow cytometry.
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
PRH1 RNAi
H00005554-R02
Species: Hu
Claspin Antibody
NB100-247
Western Blot: Claspin Antibody [NB100-247] - Detection of Human Claspin by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-Claspin antibody NB100-247 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: Claspin Antibody [NB100-247] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti-Claspin used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Claspin Antibody [NB100-247] - Detection of human Claspin on HeLa whole cell lysate using NB100-247.
(12 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
NLRP2/NALP2
Antibody
NB100-56155
Western Blot: NLRP2/NALP2 Antibody [NB100-56155] - Analysis of NLRP2/NALP2 using antibody at 1:2000. HEK293T: mock transfected cells, HEK293T-NALP2:NALP2 transiently transfected cells; THP-1: untreated cells; THP1-LPS: cells treated with 1 ug/ml LPS for4h. MCF-7: untreated cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP
ATRIP Antibody
(OTI5E7)
NBP2-02004
Western Blot: ATRIP Antibody (5E7) [NBP2-02004] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-ATRIP monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: ATRIP Antibody (5E7) [NBP2-02004] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ATRIP.
Immunohistochemistry-Paraffin: ATRIP Antibody (5E7) [NBP2-02004] - Staining of paraffin-embedded Human tonsil using anti-ATRIP mouse monoclonal antibody.
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Recombinant Human
TEM8/ANTXR1 Protein
H00084168-Q01
Recombinant Human TEM8/ANTXR1 Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no publications for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no reviews for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEM8/ANTXR1 Products

Bioinformatics Tool for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Discover related pathways, diseases and genes to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Discover more about diseases related to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).
 

Pathways for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

View related products by pathway.

PTMs for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Learn more about PTMs related to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).

Blogs on TEM8/ANTXR1

There are no specific blogs for TEM8/ANTXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SDS-Page: Recombinant Human TEM8/ANTXR1 Protein [H00084168-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human TEM8/ANTXR1 Protein
H00084168-P01-10ug
Western Blot: Nbs1 Antibody [NB100-143] - TIG-1 human primary fibroblasts, whole cell lysate (30 ug). Image from verified customer review.
Nbs1 Antibody
NB100-143
Western Blot: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Detection in TEM8 transfected cell lysate using this antibody.
TEM8/ANTXR1 Antibody (200C1339(SB20))
NB100-56585
Western Blot: Mre11 Antibody [NB100-142] - Analysis of Mre11 on 50 ug of HeLa and MEF lysates, using NB100-142.
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TEM8/ANTXR1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ANTXR1
Entrez