Recombinant Human TEM8/ANTXR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TEM8/ANTXR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 201-305 of Human ANTXR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ANTXR1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TEM8/ANTXR1 Protein

  • anthrax toxin receptor 1
  • ANTXR1
  • ATR2310008J16Rik
  • FLJ10601
  • FLJ11298
  • FLJ21776
  • TEM8
  • TEM82810405N18Rik
  • Tumor endothelial marker 8

Background

The protein encoded by this gene is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. This protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-07799
Species: Hu
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00084168-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no publications for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no reviews for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEM8/ANTXR1 Products

Bioinformatics Tool for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Discover related pathways, diseases and genes to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Discover more about diseases related to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).
 

Pathways for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

View related products by pathway.

PTMs for TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01)

Learn more about PTMs related to TEM8/ANTXR1 Partial Recombinant Protein (H00084168-Q01).

Blogs on TEM8/ANTXR1

There are no specific blogs for TEM8/ANTXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TEM8/ANTXR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANTXR1
Entrez