TEAD4 Antibody - BSA Free

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human liver.

Western Blot: TEAD4 Antibody [NBP1-82386] - Mouse Intestine Lysate 1.0 ug/ml, gel comcentration 12%

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human heart.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TEAD4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide towards Tead4. Peptide sequence RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TEAD4 Antibody - BSA Free

• EFTR-2
• hRTEF-1B
• related transcription enhancer factor 1B
• RTEF1RTEF-1
• TCF13L1MGC9014
• TEA domain family member 4TEF3
• TEAD-4
• TEF-3
• TEFR-1
• Transcription factor 13-like 1
• Transcription factor RTEF-1
• transcriptional enhancer factor 1-related
• transcriptional enhancer factor 3
• transcriptional enhancer factor TEF-3

Background

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD4
• Uniprot:
  • NP_035697(Mouse)