TEAD4 Antibody (8R0N1)

Western Blot: TEAD4 Antibody (8R0N1) [NBP3-33455] - Western blot analysis of various lysates, using TEAD4 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 8R0N1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TEAD4 Antibody (8R0N1) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 140-240 of human TEAD4 (Q15561).
  
  Sequence:
  SATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TEAD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TEAD4 Antibody (8R0N1)

• EFTR-2
• hRTEF-1B
• related transcription enhancer factor 1B
• RTEF1RTEF-1
• TCF13L1MGC9014
• TEA domain family member 4TEF3
• TEAD-4
• TEF-3
• TEFR-1
• Transcription factor 13-like 1
• Transcription factor RTEF-1
• transcriptional enhancer factor 1-related
• transcriptional enhancer factor 3
• transcriptional enhancer factor TEF-3

Background

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD4