![Immunohistochemistry-Paraffin: TEAD3 Antibody [NBP1-83949] - Staining of human placenta shows nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TEAD3-Antibody-Immunohistochemistry-Paraffin-NBP1-83949-img0002.jpg "Immunohistochemistry-Paraffin: TEAD3 Antibody [NBP1-83949] - Staining of human placenta shows nuclear positivity in trophoblastic cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEK |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TEAD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-NBP2-46376-img0001.jpg)
-Immunohistochemistry-NBP2-46376-img0002.jpg)
-Immunohistochemistry-NBP2-46376-img0003.jpg)
-Immunohistochemistry-NB110-78644-img0002.jpg)
![Western Blot HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Western_Blot_5782.jpg)
![Immunocytochemistry HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Immunocytochemistry__Immunofluorescence_19725.jpg)
-Flow-Cytometry-NB300-537-img0007.jpg)
-Western-Blot-NB300-537-img0006.jpg)
-Flow-Cytometry-NB300-537-img0008.jpg)
| Publication using NBP1-83949 | Applications | Species |
|---|---|---|
| Hazra R, Brine L, Garcia L et al. Platr4 is an early embryonic lncRNA that exerts its function downstream on cardiogenic mesodermal lineage commitment Developmental cell 2022-11-07 [PMID: 36347239] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for TEAD3 Antibody (NBP1-83949)Discover more about diseases related to TEAD3 Antibody (NBP1-83949).
| Pathways for TEAD3 Antibody (NBP1-83949)View related products by pathway.
|
PTMs for TEAD3 Antibody (NBP1-83949)Learn more about PTMs related to TEAD3 Antibody (NBP1-83949).
| Research Areas for TEAD3 Antibody (NBP1-83949)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TEAD3 |
-Immunoprecipitation-H00007004-M01-img0006.jpg)
-Western-Blot-H00007004-M01-img0007.jpg)
-Western-Blot-H00007004-M01-img0010.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")