TEAD3 Antibody

Images

 
Immunohistochemistry-Paraffin: TEAD3 Antibody [NBP1-83949] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEAD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEK
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEAD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEAD3 Protein (NBP1-83949PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEAD3 Antibody

  • DTEF-1
  • ETFR-1
  • TEA domain family member 3TEAD-3
  • TEAD5TEF5TEA domain family member 5
  • TEF-5
  • transcriptional enhancer factor 5
  • Transcriptional enhancer factor TEF-5 (DTEF-1)
  • transcriptional enhancer factor TEF-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-36953
Species: Hu
Applications: PEP-ELISA, WB
H00007004-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, WB
NBP2-84300
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC, WB
NBP2-16019
Species: Hu
Applications: IHC, IHC-P, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2444
Species: Hu
Applications: IHC, WB
AF5626
Species: Hu
Applications: ICC, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83949
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TEAD3 Antibody (NBP1-83949) (0)

There are no publications for TEAD3 Antibody (NBP1-83949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEAD3 Antibody (NBP1-83949) (0)

There are no reviews for TEAD3 Antibody (NBP1-83949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TEAD3 Antibody (NBP1-83949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEAD3 Products

Array NBP1-83949

Bioinformatics Tool for TEAD3 Antibody (NBP1-83949)

Discover related pathways, diseases and genes to TEAD3 Antibody (NBP1-83949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEAD3 Antibody (NBP1-83949)

Discover more about diseases related to TEAD3 Antibody (NBP1-83949).
 

Pathways for TEAD3 Antibody (NBP1-83949)

View related products by pathway.

PTMs for TEAD3 Antibody (NBP1-83949)

Learn more about PTMs related to TEAD3 Antibody (NBP1-83949).
 

Research Areas for TEAD3 Antibody (NBP1-83949)

Find related products by research area.

Blogs on TEAD3

There are no specific blogs for TEAD3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEAD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD3