TEAD2 Antibody - Azide and BSA Free

Western Blot: TEAD2 Antibody [NBP3-05267] - Analysis of extracts of various cell lines, using TEAD2 antibody (NBP3-05267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Product Discontinued

TEAD2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 217-280 of human TEAD2 (NP_003589.1). AWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TEAD2 Antibody - Azide and BSA Free

• TEA domain family member 2TEF4ETF
• TEAD-2
• TEF-4
• transcriptional enhancer factor TEF-4

Background

Putative transcription factor that binds to the SPH and GT-IIC "enhansons" (5'-GTGGAATGT-3'). May be involved in the gene regulation of neural development. Binds to the M-CAT motif

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for TEAD2 Antibody (NBP3-05267)(1)

Publication using NBP3-05267

• Matthew Grove, Hyukmin Kim, Shuhuan Pang, Jose Paz Amaya, Guoqing Hu, Jiliang Zhou, Michel Lemay, Young-Jin Son, Klaus-Armin Nave, Timothy E Behrens TEAD1 is crucial for developmental myelination, Remak bundles, and functional regeneration of peripheral nerves eLife 2024-03-08 [PMID: 38456457]

Bioinformatics

• Gene Symbol: TEAD2