TDRD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TDRD3 Antibody [NBP2-68850] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
TDRD3 Recombinant Protein Antigen (NBP2-68850PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TDRD3 Antibody

  • FLJ21007
  • tudor domain containing 3
  • tudor domain-containing protein 3

Background

TDRD3 may play a role in the assembly and/or disassembly of mRNA stress granules and in the regulation oftranslation of target mRNAs. Binds Arg/Gly-rich motifs in dimethylarginine-containing proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47302
Species: Hu, Mu
Applications: IP, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
NBP2-52457
Species: Ha, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IF, IHC, IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-79842
Species: Hu, Mu
Applications: IP, WB
NBP2-45763
Species: Hu, Mu
Applications: IHC, WB
NB100-56374
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP3-16849
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89546
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-43744
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
AF6286
Species: Hu
Applications: IHC, WB
NB300-259
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-68850
Species: Hu
Applications: ICC/IF

Publications for TDRD3 Antibody (NBP2-68850) (0)

There are no publications for TDRD3 Antibody (NBP2-68850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD3 Antibody (NBP2-68850) (0)

There are no reviews for TDRD3 Antibody (NBP2-68850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TDRD3 Antibody (NBP2-68850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD3 Products

Bioinformatics Tool for TDRD3 Antibody (NBP2-68850)

Discover related pathways, diseases and genes to TDRD3 Antibody (NBP2-68850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD3 Antibody (NBP2-68850)

Discover more about diseases related to TDRD3 Antibody (NBP2-68850).
 

Pathways for TDRD3 Antibody (NBP2-68850)

View related products by pathway.

PTMs for TDRD3 Antibody (NBP2-68850)

Learn more about PTMs related to TDRD3 Antibody (NBP2-68850).
 

Research Areas for TDRD3 Antibody (NBP2-68850)

Find related products by research area.

Blogs on TDRD3

There are no specific blogs for TDRD3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD3