We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TDP1 Recombinant Protein Antigen

Images

 
There are currently no images for TDP1 Recombinant Protein Antigen (NBP2-56309PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TDP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TDP1.

Source: E. coli

Amino Acid Sequence: STSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TDP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56309.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TDP1 Recombinant Protein Antigen

  • EC 3.1.4
  • EC 3.1.4.-
  • FLJ11090
  • MGC104252
  • SCAN1
  • Tyr-DNA phosphodiesterase 1
  • tyrosyl-DNA phosphodiesterase 1

Background

TDP1 is encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6720
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-50071
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-98661
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92299
Species: Hu
Applications: WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, COMET, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, mIF, PLA, Simple Western, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-87154
Species: Hu
Applications: COMET, ICC/IF, IHC,  IHC-P, KD, mIF, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
NBP2-13283
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-44912
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP1-49924
Species: Hu
Applications: ICC/IF, IP, WB
NB100-79809
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP
NB100-40842
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-56309PEP
Species: Hu
Applications: AC

Publications for TDP1 Recombinant Protein Antigen (NBP2-56309PEP) (0)

There are no publications for TDP1 Recombinant Protein Antigen (NBP2-56309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDP1 Recombinant Protein Antigen (NBP2-56309PEP) (0)

There are no reviews for TDP1 Recombinant Protein Antigen (NBP2-56309PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TDP1 Recombinant Protein Antigen (NBP2-56309PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TDP1 Products

Research Areas for TDP1 Recombinant Protein Antigen (NBP2-56309PEP)

Find related products by research area.

Blogs on TDP1

There are no specific blogs for TDP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TDP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TDP1