TDG Antibody

Images

 
Western Blot: TDG Antibody [NBP2-13423] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: TDG Antibody [NBP2-13423] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TDG Antibody [NBP2-13423] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFR EGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TDG Protein (NBP2-13423PEP)
Publications
Read Publication using NBP2-13423.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDG Antibody

  • EC 3.2.2.29
  • TDG
  • thymine-DNA glycosylaseG/T mismatch-specific thymine DNA glycosylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA

Publications for TDG Antibody (NBP2-13423)(1)

Reviews for TDG Antibody (NBP2-13423) (0)

There are no reviews for TDG Antibody (NBP2-13423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TDG Antibody (NBP2-13423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDG Products

Bioinformatics Tool for TDG Antibody (NBP2-13423)

Discover related pathways, diseases and genes to TDG Antibody (NBP2-13423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDG Antibody (NBP2-13423)

Discover more about diseases related to TDG Antibody (NBP2-13423).
 

Pathways for TDG Antibody (NBP2-13423)

View related products by pathway.

PTMs for TDG Antibody (NBP2-13423)

Learn more about PTMs related to TDG Antibody (NBP2-13423).
 

Research Areas for TDG Antibody (NBP2-13423)

Find related products by research area.

Blogs on TDG

There are no specific blogs for TDG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDG
Entrez