We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human TCR alpha GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human TCR alpha GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 133-232 of Human TCR alpha

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TCR alpha GST (N-Term) Protein

  • C)
  • D
  • FLJ22602
  • J
  • MGC117436
  • MGC22624
  • MGC23964
  • MGC71411
  • T cell receptor alpha locus
  • T-cell antigen receptor, alpha polypeptide
  • T-cell receptor, alpha (V
  • TCRA
  • TCRD
  • TRA

Background

T cell receptor (TCR) is a heterodimer consisting of an 945; and a 946; chain (TCR alpha/beta) or a 947; and a delta chain (TCR gamma/delta). TCR-beta is a member of the immunoglobulin superfamily and a component of the CD3/TCR complex (along with TCR-alpha). It is expressed on alpah/beta TCR-bearing T cells and thymocytes. The CD3/TCR complex plays a key role in antigen recognition, signal transduction, and T cell activation. The MAB0872 antibody does not cross-react with delta/gamma TCR-bearing T cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006976-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-74080
Species: Hu
Applications: WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-92603
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-24686
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP3-47457
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB100-41371
Species: Hu, Ma
Applications: Flow, IHC,  IHC-P, PEP-ELISA
NB100-178
Species: Hu, Mu(-)
Applications: ICC/IF, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB

Publications for TCR alpha Partial Recombinant Protein (H00006955-Q01) (0)

There are no publications for TCR alpha Partial Recombinant Protein (H00006955-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCR alpha Partial Recombinant Protein (H00006955-Q01) (0)

There are no reviews for TCR alpha Partial Recombinant Protein (H00006955-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCR alpha Partial Recombinant Protein (H00006955-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCR alpha Products

Research Areas for TCR alpha Partial Recombinant Protein (H00006955-Q01)

Find related products by research area.

Blogs on TCR alpha.

Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency
Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us.  CD3 (cluster of differentiation 3) is one component of our immune signal response that is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TCR alpha GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRA