Recombinant Human TCIRG1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TCIRG1 Protein [H00010312-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human TCIRG1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 138-235 of Human TCIRG1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TCIRG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TCIRG1 GST (N-Term) Protein

  • a3
  • Atp6i
  • ATP6N1C
  • ATP6N1Cspecific 116-kDa vacuolar proton pump subunit
  • ATP6V0A3T-cell immune response cDNA 7
  • OC-116 kDa
  • OC116
  • OC-116
  • OC-116kDa
  • OC116Vph1
  • OPTB1
  • Osteoclastic proton pump 116 kDa subunit
  • Stv1
  • T-cell immune regulator 1
  • T-cell immune response cDNA7 protein
  • T-cell, immune regulator 1
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • TCIRG1
  • TIRC7
  • TIRC7ATPase, H+ transporting, 116kD
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • V-ATPase 116 kDa isoform a3
  • V-ATPase 116-kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 3
  • V-type proton ATPase 116 kDa subunit a

Background

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
H00005355-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB

Publications for TCIRG1 Partial Recombinant Protein (H00010312-Q02) (0)

There are no publications for TCIRG1 Partial Recombinant Protein (H00010312-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCIRG1 Partial Recombinant Protein (H00010312-Q02) (0)

There are no reviews for TCIRG1 Partial Recombinant Protein (H00010312-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCIRG1 Partial Recombinant Protein (H00010312-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCIRG1 Products

Research Areas for TCIRG1 Partial Recombinant Protein (H00010312-Q02)

Find related products by research area.

Blogs on TCIRG1

There are no specific blogs for TCIRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TCIRG1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TCIRG1