TCIRG1 Antibody (6H3) - Azide and BSA Free Summary
| Immunogen |
TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL |
| Specificity |
TCIRG1 - T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (6H3) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TCIRG1 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Frozen
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TCIRG1 Antibody (6H3) - Azide and BSA Free
Background
Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA
Species: Hu
Applications: ICC/IF, IP, WB
Publications for TCIRG1 Antibody (H00010312-M01)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00010312-M01 |
Applications |
Species |
| X Xian, R Moraghebi, H Löfvall, A Fasth, K Henriksen, J Richter, NB Woods, I Moscatelli Generation of gene-corrected functional osteoclasts from osteopetrotic induced pluripotent stem cells Stem Cell Res Ther, 2020-05-15;11(1):179. 2020-05-15 [PMID: 32414402] |
|
|
| Capo V, Penna S, Merelli I et al. Expanded circulating hematopoietic stem/progenitor cells as novel cell source for the treatment of TCIRG1 osteopetrosis. Haematologica. 2020-01-16 [PMID: 31949009] |
|
|
| Henriksen K, Andreassen KV, Thudium CS et al. A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts. Bone. 2012-06-19 [PMID: 22722081] |
|
|
| Schinke T, Schilling AF, Baranowsky A et al. Impaired gastric acidification negatively affects calcium homeostasis and bone mass. Nat Med. 2009-06-01 [PMID: 19448635] |
|
|
| Schulz N, Dave MH, Stehberger PA et al. Differential Localization of Vacuolar H+-ATPases Containing a1, a2, a3, or a4 (ATP6V0A1-4) Subunit Isoforms Along the Nephron. Cell Physiol Biochem;20(1-4):109-20. 2007-01-01 [PMID: 17595521] |
|
|
Reviews for TCIRG1 Antibody (H00010312-M01) (0)
There are no reviews for TCIRG1 Antibody (H00010312-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCIRG1 Antibody (H00010312-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCIRG1 Products
Research Areas for TCIRG1 Antibody (H00010312-M01)
Find related products by research area.
|
Blogs on TCIRG1