TCIRG1 Antibody (6H3)

Images

 
Western Blot: TCIRG1 Antibody (6H3) [H00010312-M01] - Detection against Immunogen (36.74 KDa) .

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-Fr
Clone
6H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCIRG1 Antibody (6H3) Summary

Immunogen
TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Specificity
TCIRG1 - T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (6H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCIRG1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00010312-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCIRG1 Antibody (6H3)

  • a3
  • Atp6i
  • ATP6N1C
  • ATP6N1Cspecific 116-kDa vacuolar proton pump subunit
  • ATP6V0A3T-cell immune response cDNA 7
  • OC-116 kDa
  • OC116
  • OC-116
  • OC-116kDa
  • OC116Vph1
  • OPTB1
  • Osteoclastic proton pump 116 kDa subunit
  • Stv1
  • T-cell immune regulator 1
  • T-cell immune response cDNA7 protein
  • T-cell, immune regulator 1
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • TCIRG1
  • TIRC7
  • TIRC7ATPase, H+ transporting, 116kD
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • V-ATPase 116 kDa isoform a3
  • V-ATPase 116-kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 3
  • V-type proton ATPase 116 kDa subunit a

Background

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP3-06290
Species: Hu
Applications: IHC, IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB

Publications for TCIRG1 Antibody (H00010312-M01)(3)

Reviews for TCIRG1 Antibody (H00010312-M01) (0)

There are no reviews for TCIRG1 Antibody (H00010312-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCIRG1 Antibody (H00010312-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCIRG1 Products

Bioinformatics Tool for TCIRG1 Antibody (H00010312-M01)

Discover related pathways, diseases and genes to TCIRG1 Antibody (H00010312-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCIRG1 Antibody (H00010312-M01)

Discover more about diseases related to TCIRG1 Antibody (H00010312-M01).
 

Pathways for TCIRG1 Antibody (H00010312-M01)

View related products by pathway.

PTMs for TCIRG1 Antibody (H00010312-M01)

Learn more about PTMs related to TCIRG1 Antibody (H00010312-M01).
 

Research Areas for TCIRG1 Antibody (H00010312-M01)

Find related products by research area.

Blogs on TCIRG1

There are no specific blogs for TCIRG1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCIRG1 Antibody (6H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TCIRG1
OMIM